Call Now

Recombinant Protein to Mus musculus (Mouse) Scavenger Receptor Class D Member 1 (SCARD1)

CD68; GP110; Macrosialin; Macrophage Antigen CD68

Description Scavenger Receptor Class D Member 1 (SCARD1)
Catalog Number V570Mu01
Organism Species Mus musculus (Mouse)
Source Prokaryotic expression
Expression System E.coli
Endotoxin Level <1.0EU per 1µg (determined by the LAL method)
Subcellular Localization n/a
Predicted Molecular Mass 61.4kDa
Accurate Molecular Mass n/a
Residues & Tags Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA with N-terminal His and GST Tag
Buffer Formulation 20mM Tris, 150mM NaCl,pH8.0,5% Trehalose and Proclin300.
Form Supplied Lyophilized powder
Purity Purity was assessed by SDS-PAGE (≥98%) and by HPLC.
SDS-PAGE
Isoelectric Point 8.0
Applications Positive Control; Immunogen; SDS-PAGE; WB.
Storage Instruction We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or –20°C for future use.
Stability The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Notes For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.

Related Products:

Catalog NO. Product Name Product Type Organism species
KEV570Hu Scavenger Receptor Class D Member 1 (SCARD1) ELISA kit Homo sapiens (Human)
MV570Hu21 Scavenger Receptor Class D Member 1 (SCARD1) Monoclonal Antibody Homo sapiens (Human)
PV570Hu01 Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody Homo sapiens (Human)
PV570Mu01 Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody Mus musculus (Mouse)
V570Hu01 Scavenger Receptor Class D Member 1 (SCARD1) Recombinant Protein Homo sapiens (Human)
V570Mu01 Scavenger Receptor Class D Member 1 (SCARD1) Recombinant Protein Mus musculus (Mouse)